Top 10k strings from 16-48 Magazine - Issue 17 (1985)(16-48 Tape Magazine)(Side A).tzx
in <root> / bin / z80 / software / Sinclair Spectrum Collection TOSEC.exe / Sinclair ZX Spectrum - Magazines / Sinclair ZX Spectrum - Magazines - [TZX] (TOSEC-v2007-01-01) /
Back to the directory listing
8 GGGGGGGGGGGGGGGG 5 B.C.THORNE APRIL 1983*S\ 5 444444444444444444444444444444 4 16/48 script 4 ((prog+474 4 16/48 Magazine Ltd. *6\$: 3 z$="11000404A": 3 z$="07000404Q": 3 gazine Ltd. *6\$: 3 MEDIOCRE!": 3 FANTASTIC!": 3 ;"SYMBOLS" 3 ;"SHERLOCK 3 ;"Ludoid4 3 "Nothing happens": 2 z$="09020203STOP THE TAPE": 2 Press any key 2 LET THE TAPE RUN 2 C$=Q$(Q+I,W+I) 2 Argus Press 2 A$="CHEST": 2 ;"tutor8": 2 ;"16/48TITLE" 2 ;" ": 2 88888888888888888888888888888888 2 8888888888888 2 )))))))111111111111111111))))))))))))11111000000000000001111)))))))11000000000000000000000111))))1110000000000000000000000111)))111000000000000000000000000011111000000000000000000000000000011100000000000000000000000000000011000000000000000000000220000000110000000000000000000022222000000100000000000000000000222220000001000000000000000000000222000000010000000000000000000000000000000100000000000000000000000000000001000000000000000000000000000000010000000000000000000000000000000100000000000000000000000000000001000000000000000x000000000000000110000000000000000000000000000001100000000000000000000000000000011100000000000000000000000000001111000000000000000000000000000011) 2 $8888888888888888888888888888888888888888888888888888888888888888888888 2 "You cannot": 2 "SHERLOCK 2 "PROG+239", 2 "I cannot help you": 2 "20")="d": 2 % 2 ": 1 z$="19000203CONGRATULATIONS!": 1 z$="13030305CHAPTER 8": 1 z$="13000404A": 1 z$="12000204Let the tape run": 1 z$="11250103Cyclapes": 1 z$="11060203Ludoids": 1 z$="10030203STOP THE TAPE": 1 z$="10030203RUN THE TAPE": 1 z$="10020203RUN THE TAPE": 1 z$="10000202Let the tape run": 1 z$="09000404Q": 1 z$="08240102Chapter 4": 1 z$="06070105MACHINE CODE TUTOR": 1 z$="06050202BIT n,r": 1 z$="06010202HELP IS AT HAND": 1 z$="0310020216/48": 1 z$="00050102WHAT'S IT ALL ABOUT?": 1 z$="00020202PRESSING KEYS": 1 z$="00010302OTHER TIPS": 1 z$="00010202NOW IN Z80 CODE": 1 z$="00010102WHERE ARE THE KEYBOARD PORTS?": 1 z$="00000805EDIT": 1 z$="0000060516 48": 1 z$="00000402USING IN": 1 z$="00000402THE BITS": 1 z$="00000202THAT'S ALL FOLKS": 1 z$="00000202TESTING THE BITS": 1 y$="You see ": 1 x,y;b$(n);: 1 x"'"POKE 23606,x-256* 1 w=w+(Q$(q+1 1 tutor8 1 to Re-read"''" 1 t$="ansew00 #00000000GdjbB00" 1 prog+730,"; 1 micro h 1 mail V 1 k$=k$+a$(n) 1 hidden door 1 f,o;" ": 1 edit 1 d$="nsew": 1 d$="n w": 1 d$=" sew": 1 c$=q$(n,m) 1 c$="--------": 1 b$="letter words only": 1 b$="Welcome to chapter 4 of THE LUDOIDS | ": 1 b$="This month youare following the LUDOIDS | to the planet MOUNT CYCLO": 1 b$="ENTER the code from last months game (OR hit ENTER)": 1 b$="Do you want a print out (y/n)": 1 b$="Do you want instructions ? (y/n)": 1 agazine Ltd*S\ 1 a$="take this opportunity to" 1 a$="solve the jumbled pictures!!!": 1 a$="routine in #12. ": 1 a$="readers :- ": 1 a$="product that you have developed": 1 a$="frustrated competition fans.": 1 a$="for many of us BASIC bashers.": 1 a$="excellent and innovative": 1 a$="courtesy of your 'ZOUNDS' ": 1 a$="an animated sequence HOW to ": 1 a$="The light is beginning to dawn": 1 a$="TREE": 1 a$="SCORP": 1 a$="SAND": 1 a$="MACHINE CODE TUTOR series. ": 1 a$="I have even been spurred to use": 1 a$="Finally some points for the ": 1 a$="DETEC": 1 a$="Can you please show by means of": 1 a$="CYCL": 1 a$="CHEST": 1 a$="And now a PLEA on behalf of all": 1 a$="1. THE CODE FOR THE SOUNDS USED": 1 a$="(Maybe next month!? Ed.)": 1 a$=" PRESS ANY KEY TO CONTINUE": 1 a$=" Now that 1985 is here may I": 1 a$=" " 1 a$=" 1 Z$="15"+E$+"0304"+M$: 1 Z$="10030203RUN THE TAPE": 1 Z$="01010205CUSTARD PIE": 1 You'll find my entry for the 1 X,X;"YIPPEA!!!!" 1 WEAR CHINA MANS 1 W=W-(Q$(Q+1 1 W-I)+T$+M$(W+I 1 UUU_UUUUUV 1 UUU_UUUUUUw 1 UUU_UUUUUU[ 1 UUU_UUUUUUV 1 UUU_UUUUUUU 1 UUU_UUUUUU> 1 UUU_UUUUUU 1 To be absolutely fair,this is the only criticism I have with regard to 1 The M/C TUTOR is 1 The LUDOIDS is 1 The CROSSWORD is 1 T=S+(P-I): 1 SYMBOLS 1 STOP THE TAPE 1 START THE TAPE 1 SLATER STREET" 1 SAY TO COOK ~TELL ME ABOUT BASIL PHIPPS~"'" 1 S=(R*P)+I: 1 RUN THE TAPE 1 Q$="Guesses:"+d$: 1 Program by B.C.Thorne September 1984*K\~ 1 PRESS ANY KEY 1 PLAY TAPE" 1 PIE 1 Other points of feedback:" 1 OPEN DRAWER 1 Major Ffoulkes 1 M$=T$+M$(2 1 London W4 4PH. 1 LWH Volume 2 1 LUDOIDS #4 1 LOOK THROUGH HIDDEN DOOR"'"What he saw gave him a clue to the method of entry." 1 LIVE WIRE 1 LINE PRINT ROUTINE 1 LETTER 1 LD HL,4001h 33,1,64" 1 LD BC,64510 1,254,251" 1 L$=" ": 1 J$="--------------------": 1 I$="))))))))))))))))))))": 1 Greetings again!"''"Another ~pretty missive~ with more suggestions and comments!" 1 G ""BOOKLIST""*" 1 Firstly; What happened to the cassette inlay card?"'"Ever since 1 F ""CROSSWORD"" 1 E ""comp17"" 1 DARK STAR COMPETITION 1 D ""BULLETIN"" 1 Congratulations ! 1 CUSTARD 1 CURSOR UP & DOWN, 0 TO mOVE ON. (R to run code Q to stop code.) 1 C$=C$+" ? ": 1 C$="WAIT FOR A WHILE": 1 C$="QUIT GAME": 1 C$="INVENTORY": 1 C$="HELP": 1 C$="GO WEST": 1 C$="GO UP ": 1 C$="GO SOUTH": 1 C$="GO NORTH": 1 C$="GO EAST": 1 C$="GO DOWN": 1 C ""REVIEWS"" 1 B<<dDd$fB~<B 1 B< P\B]]B< 1 B///////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////-///////////////////////////////-////////((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((,,,((((((,,,,,,(,((((((((((((,,,++***(++++++++*********(+(++++++ 1 B$=B$+" 1 B$="You can only take the detector with you.": 1 B$="Do you want toSAVE this program ?": 1 B ""FIGCHESS""* 1 Arrowhead Software 1 ARGUS PRESS SOFTWARE GROUP 1 A$="some M/C in this letter": 1 A$="POKE 23607,60 . ": 1 A$="Keep up the good work with the": 1 A$="IS 1016 BYTES LONG STARTING AT": 1 A$="IN THIS LETTER IS FROM 31510 -": 1 A$="CHARACTERS,POKE 23606,0 AND": 1 A$="BINO": 1 A$="31534. RUN BY RAND USR 31510.": 1 A$="2. THE ALTERNATE CHARSET USED": 1 A$=" compliment you on the": 1 A$=" Dear 1 A$=" Q TO QUIT R TO READ AGAIN": 1 A$=" T.JANE": 1 A ""16/48D&G17"" 1 ;;;;;;;;;;;;;;;;888;;;;;;;;;;;;;;;;;;;;;;;;;;;;8888;;;;;;;;;;;;;;;;;;;;;;;;;;;888888;;;;;;;;;;;;8;;;;;;:8888888888888888888::::88888888888888888888888888::::::8:::::::8:888888888888888:::::::::::::::88888888888888888888888::88888888xxxxxxxxxxxxxxxxx888888888888888x```````````````x888888888888888x```````````````x888888888888888x```````````````xx88888888888888x``````````````xx888888888888888xxxxxxxxxxxxxxxxx8888888888888888888xxxxxxxxxxxx88888888888888888888xxxxxxxxxxx888888888888888888888xxxxxxxxxx8888888888888888888888xxxxxxxxx88888888888888888888888xxxxxxxxx88888888888888888888888xxxxxxxxx88888888888888888888888xxxxxxxxx88888888888888888888888xxxxxxxxx88888888888888888888888xxxxxxxxx888888888888888888888888888888x88888888888888888888888888888898888888888888k 1 ;"wrote pyramania and"; 1 ;"to the crosswords?" 1 ;"provided this assistance."''"BREAK out before the 1 ;"press Y to play again, N to quit" 1 ;"own programs?" 1 ;"direct command."'"FOR n=1 1 ;"competition in issue 13?" 1 ;"cheat line as a"; 1 ;"and enter the following"; 1 ;"YOU COLLECTED ALL 25 DIODES FROM THE TWO CIRCUITS! "; 1 ;"Who won the DARKSTAR"; 1 ;"Two quick points for new readers(or reminders for old ones)."''"To save programs to microdrive you can BREAK and GOTO 9998."''"To save programs to tape you canBREAK and GOTO 9999."''"We try to make this work on as many of our programs as we can."'"(This month it works on all the programs except the adventure which has its own save option and the reviews.)" 1 ;"To use LET x= 1 ;"The following..."; 1 ;"That's all for now"''" 1 ;"Sorry this program has been"'"copied once already": 1 ;"Send letters, programs or ideas to"'" 1 ;"STOP THE TAPE"; 1 ;"STOP THE TAPE": 1 ;"SCORE:";SC;" LIVES:";L 1 ;"SAVE ""script"" 1 ;"Press any key to continue": 1 ;"Press any combination of keys 1 to 5 and see what effect they have on the value returned to the 5 least significant bits of the input port." 1 ;"Press a key": 1 ;"Press a key to Trans-mat down": 1 ;"PYRAMANIA from issue 12?" 1 ;"PRESS ANY KEY" 1 ;"PRESS ANY KEY TO CONTINUE": 1 ;"PRESS A KEY ( 1 ;"PLASTIC SAFETY-ZONE: "; 1 ;"P.Lant to"; 1 ;"Nicholas Murray"; 1 ;"MAY 1985" 1 ;"Liz Townley in Stroud,"; 1 ;"LUDOIDS #4": 1 ;"LUDOIDS #4" 1 ;"LIVE WIRE"; 1 ;"LIVE WIRE": 1 ;"LIVE WIRE" 1 ;"LETTER": 1 ;"LEAVE TAPE RUNNING": 1 ;"KEYS: Q: UP Z: DOWNP: RIGHT I: LEFT" 1 ;"If Holmes can be inside the 1 ;"Ian Davies of Birkenhead,"'"Mr J M Maybury from Walsall,"'"Sue Spence from Northampton,"'"Philip Markin in Nottinham and"'"Mr A S Miller from London NW8." 1 ;"How can I use the"; 1 ;"How can I get the solution"; 1 ;"HOW can I ever finish"; 1 ;"HOLMES HINTS"''" 1 ;"HOLMES HINTS!"''" 1 ;"HIT A KEY( 1 ;"DIODE: "; 1 ;"CUSTARD" 1 ;"CIRCUIT TWO": 1 ;"BY GRAHAM ADAIR" 1 ;"BREAK into the program,"; 1 ;"BREAK from this program,"; 1 ;"16/48TITLE": 1 ;"16/48 script in my "; 1 ;"16/48 Magazine": 1 ;"""tutor8"""'''"We continue our machine code tutor series with a look at how to read the keyboard and make appropriate decisions.": 1 ;"""micro"",""mail"""'''"Two letters this month. This oneis from Terrence Jane in Dorset.": 1 ;"""letter"""'''"Another very pretty missive fromP Lant. This one is full of SHERLOCK graphics and hints which make it a 48K program.": 1 ;"""edit"""'''"DARK STAR competition winners, the infinite lives pokes we all need to finish ""pyramania"" and details on how to cheat at the crossword."''"Plus the minimum of blurb from the font of all thingies.": 1 ;"""comp17"""'''"The BUBBLE BUS, Wizard's Lair competition. 10 copies of their latest hit game and TEN TEE SHIRTS to be won."''"All you have to do is unscramblethe loading screen from WIZARD'SLAIR and send us the proof on tape.": 1 ;"""REVIEWS"""''"Comments and screen displays from the latest software.": 1 ;"""LUDOIDS #4"""''"Chapter 4 of our new adventure with full screen graphics and fast response to instructions inordinary English.": 1 ;"""LIVE WIRE"""''"A really good example of a 16K BASIC game which, because it is based on a good idea, is much more enjoyable than many less well thought out machine code juggernauts."''"An example to us all from GrahamAdair in Edinburgh.": 1 ;"""FIGCHESS"""'''"Rob and Trevor Figgins have donethe prettiest three dimensional simulation of a chessboard ever seen on the Spectrum. Remember ""Chessfire"" in issue 1?!": 1 ;"""CUSTARD"""'''"An irresistable variation on hangman from Michael Silve.": 1 ;"""CROSSWORD"""'''"This month our first symmetricalpuzzle. Sent in by crossword compiling wizard -J Madden."''"(You too could win a portrait in brown of the lady of the lamp if you send in a good 11 by 11 crossword with solution and clues on paper!)": 1 ;"""BULLETIN"""''"We have had regular requests fora program which enabled bigprintand our scroll routines to be used together. Well here it is.": 1 ;"""BOOKLIST"""'''"An improved,expanded and updated48K data base on all Spectrum related books from Berwickshire librarian, John Luby.": 1 ;"""16/48D&G14"""''" ""OF DUNGEONS AND GREEN MEN"""''"More adventure help from YAZ.": 1 ;" You must guide THE 1 ;" YOUR NAME GOES DOWN IN HISTORY!" 1 ;" When you've collected all the Diodes in the first circuit, yougo onto a second one, but the powersurges come a little faster(just to keep you on your toes!)" 1 ;" To avoid being electrocuted youmust make sure that you are in aplastic safety-zone whenever thecurrent flows. If you get caughtout, BZZZZZZZZZZT!!" 1 ;" TAPE 17 MAY 85 SIDE 1 " 1 ;" After a while you'll get the hang of anticipating the power- -surge." 1 ;" 16/48 MAY 85 TAPE 17 " 1 ;" * FULL 48K PROGRAMS."'" (16K MACHINES WILL SKIP THESE.)": 1 ;" PRESS ANY KEY TO CONTINUE " 1 ;" ": 1 ;" " 1 ;" ": 1 8(88(88(hXp 1 63486"'"1470 LET x=x-32* 1 44444444444444444444444444444444444444444444444444444444444444444444444444444440000000000000000 1 23635+256* 1 22:GOSUB 9100:NEXT n"''"This month's program has the cheat line written in and even has a REM line highlighted in the listing. Never say we aren'thelpful." 1 16/48TITLE 1 16/48LOAD1 1 16/48 magazine, 1 16/48 TAPE 17 1 1111111111111111111111111111111111111111111111111111111111111111111 1 100 1 10 Barley Mow Passage, 1 ."''"n is a number between 0 and 7"'"r is register A,B,C,D,E,H or L." 1 . (Be my guest. Ed.)": 1 ,o;"-------------------------"; 1 ,c;" =rstuvw" 1 ,c;" KLLM " 1 ,O;"PRESS ANY KEY TO BEGIN..": 1 ,O;" "; 1 ,F;" 23": 1 ,F;" 23 ": 1 *************** 1 *"m";m;m$: 1 )+,-.012"; 1 )+". TO RETURN TO NORMAL ": 1 )))))))))))))))))))))))))"; 1 (x/256)-1."'"(POKE 23606,0:POKE 23607,60 to return to normal.)" 1 (x/256)"'"POKE 23607, 1 (This is the easiest way to get both disguises)" 1 (Interesting)" 1 (In the Browns' STUDY)" 1 (FEFEh) CAPS/SHIFT to V"'" 1 (FDFEh) A 1 (FBFEh) Q fo T"'" 1 (EFFEh) 0 to 6"'" 1 (DFFEh) P to Y"'" 1 (BFFEh) ENTER to H"'" 1 (7FFEh) SPACE to B" 1 '''''"This instruction tests bit 1 '''"This time we look at how to readthe keyboard fom within machine code programs." 1 '''"This is a little routine to do odd things with the upper screenuntil you push Q." 1 '''"These 4 lines are now runnng"''"1460 LET x= 1 '''"The outer keys (1,0,Q,P etc.) affect BIT 0, the inner keys (5,6,T,Y etc.) affect BIT 4." 1 '''"See you next month."''"Press any key to start again."''''" 1 '''"If you want to test for a combination of keys then the masking operation can be done with" 1 '''"At this stage we need to bring in a new instruction.": 1 ''"We can demonstrate the effect ofone group of five keys with a short BASIC routine." 1 ''"We also show how to avoid the problems which can arise from ignoring the subtle differences between issue 3 Spectrums and earlier models." 1 ''"These are the port addresses we need to read the keyboard." 1 ''"The Z80 has several instructionsfor reading input ports, but if we ignore the block inputs and the instructions which include incrementing or decrementing we are left with two." 1 ''"If you look at page 160 of the manual you will find these addresses. (Page 60 of the Spectrum+ User Guide has the same but with less detail.)" 1 ''"Bits 5,6 & 7 are affected by theEAR socket, the issue number of your Spectrum and cosmic rays. It is important to mask them offif they could affect your program." 1 ''" 1 ""LIVE WIRE"" 1 '"This removes irrelevant bits." 1 '"There are exits visible;"'("North," 1 '"If the bit is zero the ZERO flagis set. If not, it is reset." 1 %APS 222 REGENT STREET, LONDON W1R 7DB0 1 #p;"H = HELP"'"P = PAUSE"'"R repeats the previous command"'"Q = QUIT" 1 #p''"You will need to draw a map of where you go to avoid getting lost.": 1 #p''"Once the jammer has been"'"destroyed, you can return to"'"your spaceship by pressing the wrist detector." 1 #p'"Your mission is to find the"'"LUDOIDS |, and destroy their"'"Trans-Mat jammers" 1 #p'"You have a WRIST DETECTOR which will destroy a jammer if you"'"press it when you are near one." 1 #p'"The following letters"'"ON THEIR OWN have special"'"meanings" 1 #p'"The Computer will tell you what happens. You tell the computer what you want to do by typing inENGLISH and then pressing 1 #p'"N = Go NORTH"'"S = GO SOUTH ...etc"''"V or L Shows the VIEW"'"I = INVENTORY (""What have I got with me ?"")" 1 #p'"LOAD- allows you to load the"'"details back again." 1 #p'"Avoid negatives or trying to do more than one thing at a time." 1 #P''"SAVE- will save details of the game at any point to tape, in two short pieces of code" 1 #P''"Hi-res full screen pictures willremain displayed until you pressany key." 1 #P'"Be specific in your instructions(""TAKE THE KEY"" will be"'"understood"'"""TAKE"" will not)" 1 "zzzzzz...": 1 "prog+361": 1 "name? ";m$'"Drive ? ";m: 1 "ZINCNEWTDIRTFADEFLAGGAINFAKEGOWNSTAYHATEDUSTMASKPLUGCOMBSHOEFOOTHAIRHEATTRIMWALLBEANFINDLEADBIKEROCKTHISOVERDOWNCOOLYOKEDOCKROCKBOOKEXITLOCKOPENTARTTREEWALLHEADPEARPLUMLAMPLIONHANDNECKNOSEREADBATHSOAPFIVESHOEWOODDOWNLEFTSHOPFOURFIVENINEBLUESOCKTAPESOUPCOLDLEAFGRIPLIONQUITKEPTUTAHCORKWIREBARKGULFGREYYARDVASTBUSHHIDEJUSTRACEKNOTTURNCASTOVERSAMEPASTFOLKCASTVASEVOTEDRIPWIPEKITEHARPEXITZEST" 1 "You take the ";m$: 1 "You see nothing more to help you": 1 "You see a chest in the sand.": 1 "You need to get into the game more!": 1 "You made it !": 1 "You kill the SCORPION": 1 "You have with you;": 1 "You have nothing to feed them"'"with.": 1 "You have nothing to eat": 1 "You have nothing to drink": 1 "You have not found the"'"co-odinates yet !": 1 "You have not destroyed the "'"jammer yet": 1 "You get into the chest, you are able to paddle it": 1 "You find an island of banana"'"trees": 1 "You fall off the edge of the"'"planet.": 1 "You drown in a whirlpool": 1 "You drop the ";m$: 1 "You don't find anything": 1 "You do not have the correct key": 1 "You cannot" 1 "You cannot go in that direction": 1 "You can see; ";m$ 1 "You are still on the shore of"'"the large lagoon": 1 "You are still on the shore line.": 1 "You are on the shore of a large lagoon": 1 "You are on an island with bananatrees on": 1 "You are not strong enough": 1 "You are in the cave with a ";("dead " 1 "You are in the Lagoon.": 1 "You are ignored": 1 "You are getting the scorpion"'"very annoyed.": 1 "You are eaten alive by piranha.": 1 "YELLOWCHURCHSOCKETSCHOOLFATHERMOTHERUMPIRESPRIALLEGACYFINISHKETTLEFALCONDEGREESPONGESNEEZENATURENAPKINMELODYMEMORYZODIACWEEVILPLAGUELITMUSWREATHCHINTZGROTTODRAGONZENITHRECORDACROSSAROUNDANIMALBURROWBRANCHWEAPONBRIDGECAUGHTVISIONMUTINYBOTTLEORANGEMIRRORJACKETCARPETFOLDERPILLOWBANANAPEANUTSPIDERFRIDGEZIPPERROTTENSECONDHOLLOWDEVISESQUEALVOYAGEDEVOIDTICKETVIOLETJUMPER" 1 "What are you going to do ?"'" 1 "Unable to follow him through the 1 "Tread carefully this has the"'"stamp of a Ludoid trap.": 1 "Time passes...": 1 "This SAVEs this stage of the"'"game on to tape."'"Do you want to carry on ? Y/N": 1 "This LOADS a previous game from tape"'"Do you want to continue ? Y/N" 1 "They have a ludoid symbol (|) onthem, 1 "There is something buried in thesand": 1 "There is no reply": 1 "There is a cave entrance to the South. You see some CYCLAPES ": 1 "The scorpion stings your ankle. You are killed": 1 "The scorpion is slowly advancingtowards you": 1 "The lagoon is to the north": 1 "The key does not fit": 1 "The cyclapes rush to the bananas.": 1 "The Cyclapes block your way": 1 "The Cyclapes are hungry."'"One of them has a pair of"'"binoculars !": 1 "Sorry, I didn't understand."'"Try again.": 1 "Rewind Tape & play to 1 "RUGAXEWINTOPACTENDICEDRYTEACATDOGBATHATCARFARSATMATRATOUTANDBYEENDBOXPENCUPBEDEYEZOOLEGBAGPOTYOUWASBUSONETWOSIXTENREDTRYPIPJAMTOERIPBIGSOWPIGHOTLIDSAYBEEANTDIGEARWIGZIPKEGPITDAYUSENOWFEWBUTHASSKYPINSEAKEYBARFORDIPWETRUNSUN" 1 "REWIND TAPE & PLAY": 1 "Put empty cartridge in drive 1"'" 1 "PLAY THE TAPE": 1 "OMNIBUSPLATOONGRUMMETPALETTELIQUEURPLATEAUTANKARDTRIUMPHWEATHERZEALOUSEXHAUSTEXHIBITMENTIONMELANINNAUGHTYOBVIOUSOBELISKOBSERVESPONSORELEMENTEMBARGOFICTIONHAULAGEHORIZONMAGENTAORCHARDORGANICPARSNIPPENGUINPERFUMEABILITYADDRESSALCOHOLANAGRAMCLIMATEADAPTOREXAMPLEJEALOUSJUGULARKETCHUPKINGDOMKNUCKLELACQUERCUSHIONBROTHERECONOMYBISCUITSHAMPOOVINEGARPARADOXGRIZZLEANXIOUSPASSAGETRAFFIC" 1 "OMEGAALPHANICHEDIRTYFIELDFIBREFETCHHABITGYSPYHAZELGRAPHBRUSHPLACESHIRTPOUNDCHAINPLANESPORTRADIORANGEFIRSTWORLDCOUNTMOUSEHOUSENIGHTCHILDNURSEINDEXFLASHMELONRHINOCLOCKAPPLEVIDEOPAPERGLASSFLOORFRUITTIGERZEBRATOOTHWATERUNDERCLOSERIGHTBARGETHREESEVENEIGHTGREENBLACKWHITEBLITZFIGHTLIGHTCHAIRGRASSBREADTOASTCHICKKNIFEQUICKCARRYCAMELUNCLESUPERDOUGH" 1 "Make sure that your map is"'"accurate": 1 "Loading code": 1 "Load DE with first screen byte address.","Load BC with number of bytes in one third of the screen.","Move all bytes on the top third of the screen one place back.","Go back to the start." 1 "Load BC with port address.","Fetch port into A.","Set ZERO FLAG if bit 0 of A is zero because Q is pressed." 1 "LUDOIDS #4" 1 "LIVE WIRE" 1 "In which direction ?": 1 "Hi there !": 1 "Following 1 "EXAMine things": 1 "ENTRY code ? (or 1 "ED B0 LDIR 237,176" 1 "ED 78 IN A,(C) 237,120" 1 "Dumb move, you are kiled.": 1 "Do you want the instructions ? (Y/N)" 1 "DETECTOR","BANANAS","BINOCULARS","CHEST","SAND" 1 "CREATURESPECTRUMOMELETTEPANCREASTAPESTRYTARRAGONVOCATIONVIOLENCEDISSOLVEDISTINCTEXERCISEINTERNALNAVIGATENICOTINEOBEDIENTOCCASIONSYMPATHYSYMPHONYSYCAMOREDEMOLISHDIRECTORELEPHANTHALLMARKLAMINATEMAGNETICOPPOSITEPARAFFINPARTICLEPENTAGONADHESIVEALPHABETGULLIBLEINSULATEJAMBOREEKILOGRAMMANDOLINMARATHONNATIONALTERMINALUMBRELLACOCKTAILBIRTHDAYELECTIONBUSINESSORNAMENTFOUNTAINSQUIRRELPERIODICELECTRICDISTANCETOMORROWCALENDARMOUNTAINMAGAZINECOMPUTER" 1 "CB 47 BIT 0,A 203,71" 1 "C9 RET 201" 1 "Are you sure ? Y/N"''"n.b. Press ""X"" to NEW this"'"program." 1 "9";"The": 1 "8","1","1000","2","2600","42","2520","43","2540","74","2540","32","2590","34","2590","35","2590" 1 "7";"Press Any Key": 1 "6";"NEVER MIND, YOU GOT ";SC;" POINTS." 1 "6","21","3030","1","2500","8","3020","72","3030","73","3030","57","3030" 1 "6"*A,B-256 1 "6")="u")+("and Down" 1 "5","2","1000","3","2400","4","1600","6","1620","7","1620","42","1520" 1 "5")="w")+("up," 1 "41165",hb: 1 "41164",lb: 1 "4";"UNFORTUNATELY YOU WERE FRAZZLED TO A LITTLE BLACK CINDER! " 1 "4","2","1400","3","1500","6","1620","7","1620" 1 "4")="e"); 1 "3";"by Michael Silve"; 1 "3","1","2400","3","1460","4","1000" 1 "3")="s")+("East," 1 "26";"PQRS": 1 "24")="1": 1 "23298",(( 1 "23296")<256 1 "23296")*(( 1 "20 01 JR NZ, 1 "2")="n")+("South," 1 "19",o;" 1 "18"+n)="G" 1 "18"+M)=r$: 1 "18"+M)="G": 1 "18")="1": 1 "18 E9 JR 1 "17",o;" 1 "17")="1": 1 "16/48TITLE" 1 "16/48LOAD1" 1 "16")="1": 1 "16"))'"scorpion"'"There is a ludoid jammer behind it": 1 "15",o;" 1 "13",o;" 1 "11",o;" 1 "11","12","1050","7","1050","8","5670","1","1420","3","1000","45","1440","42","1430","4","1460","47","1090","48","1050","30","1490" 1 "11 00 40 LD DE,4000h 17,0,64" 1 "10";"PLAY THE TAPE": 1 "10";"Make a guess": 1 "10";"CIRCUIT ONE" 1 "10","30","1490","8","1070","7","1050","1","1100","2","2500","3","2300","4","1400","47","1090","12","1050","48","1050" 1 "01 00,08 LD BC,800h 1,0,8" 1 "(prog+593)": 1 "(PROG+361)" 1 "''"You can now continue your quest."'"Write this code on the inlay"'"card so that you can start the next episode" 1 "'"This time the high byte of the address is from the A register and the low byte is N. The data goes into the A register." 1 "'"The Z80 selects input/output, acivates the READ line and puts the contents of the BC register pair onto the address bus. The data put onto the data bus then goes to r (A,B,C,D,E,H or L)." 1 "'"If it does not verify type GOTO GO": 1 "'"1480 PRINT AT 10,10;x:GOTO 1460" 1 "'" We will pay `10 for published letters or between `20 and `100 if you can send us an original program which we can feature."'"(Please enclose a SAE if you want your tape returned.)"''" Meanwhile enjoy the rest of the tape....": 1 ""a""-768"'"CLEAR x-1:LOAD"""" 1 " WELL DONE " 1 " ": 1 " ": 1 took overthe inlay card presentation has gone downhill." 1 to save the program to a blank tape"''" 1 to run the program againPress 1 to read again."; 1 to quit & load the ADVENTURE.": 1 to page backwards."''''" 1 to move on." 1 to escape." 1 to NEW it" 1 then a vital confirmation of an alibican be obtained." 1 takeover of the dear ol' mag."''" 1 some coordinates !": 1 saves to Microdrive"''" 1 on SIDE 2."''"Press 1 of register 1 if Q not pressed.","RETURN to Basic if Q is pressed.","LD HL with second screen byte address." 1 from his London lodgings one Monday night Holmes overheard him taking a cab to 1 for hard copy)" 1 around thecircuits collecting the Diodes (you score 10ptsfor each). Unfortunately, someone is switching the power on and off at regular intervals." 1 TAKE OFF"'" 1 TAKE OFF 1 Special Commands" 1 STOP THE TAPE 1 Press ""ENTER"" for another word "; 1 NEVER MIND ": 1 More than 4 letter words"; 1 INSTRUCTIONS 1 How to play the game" 1 He decided to 1 Entry code; 1 Change length 1 CLOSELY EXAMINE DRAWER "'" 1 Any length words" 1 Already guessed ": 1 7 & 8 ";b$; 1 7 ""LUDOIDS#4""* 1 6 ""tutor8"" 1 5 & 6 ";b$; 1 5 ""CUSTARD"" 1 4 ""edit"" 1 3 & 4 ";b$; 1 3 ""micro"" 1 2 ""letter""* 1 1984 A.P.S. 1 (also up&down the way)"' 1 (1Fh)(0001111 in binary)" 1 %TUVWXY"; 1 !";"""";" 1 I have found a use for the 1 HEX ASSEMBLY DECIMAL 1 !";""""; 1 !";""" "; 1 loads and add these two lines tothe short BASIC loader."'"15 POKE 30371,108"'"16 POKE 30349,0"''"Then RUN and load the rest." 1 WEAR OLD MANS 1 CHINA MANS DISGUISE!" 1 32,1" 1 24,233" 1 Program by Barry Thorne Graphics by Jim Dann